PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008224995.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 371aa    MW: 40912.4 Da    PI: 8.8588
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008224995.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.2e-53161431128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++
  XP_008224995.1  16 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILTS 109
                     79****************************.89***************8888999**************************************99 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++++vg+kk Lvfy g+ pkg k++W+mheyrl
  XP_008224995.1 110 iGNQKVGVKKALVFYGGKPPKGIKSNWIMHEYRL 143
                     89999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-6510179IPR003441NAC domain
PROSITE profilePS5100561.83516179IPR003441NAC domain
PfamPF023658.8E-2817143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MESTDSSSGS QVHPQLPPGF RFHPTDEELV VHYLKKKAAS APLPVTIIAE VDLYKFDPWE  60
LPSKATFGEQ EWYFFSPRDR KYPNGARPNR AATSGYWKAT GTDKPILTSI GNQKVGVKKA  120
LVFYGGKPPK GIKSNWIMHE YRLVNNNNNN NNFSKPPDAS NKKASLRLDD WVLCRIYKKN  180
NAQRPMMDED SSNNSMDGMF VHPSSILPAP PPPQPKHTTN YTALLENDDH EGFFEGILSS  240
SDQQGSHSHH HHHHHQHHHD QFGGISTSSS KSNLPVKRPL PSSFWNDAGS MGTAAPAATT  300
TSSSKRFHAD LNSGISATAA GGVDESNSSF VSMLNQLPQG TAPFHPNALL GSLGDGVLRQ  360
QFQHPSMNWN S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B5e-751618217168NAC domain-containing protein 19
4dul_A5e-751618217168NAC domain-containing protein 19
1ut7_B5e-751618217168NO APICAL MERISTEM PROTEIN
1ut7_A5e-751618217168NO APICAL MERISTEM PROTEIN
1ut4_B5e-751618217168NO APICAL MERISTEM PROTEIN
1ut4_A5e-751618217168NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8227090.0KR822709.1 Prunus persica NAC transcription factor NAC2 (NAC2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224995.10.0PREDICTED: NAC transcription factor 25
SwissprotQ8GY421e-113NAC25_ARATH; NAC transcription factor 25
TrEMBLM5WFT20.0M5WFT2_PRUPE; NAC transcription factor NAC2
STRINGPOPTR_0011s04650.11e-156(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-110NAC domain containing protein 25